PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI12G02760.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 378aa    MW: 42846 Da    PI: 6.1215
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI12G02760.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.74.9e-17131177148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT eEd +lv++v+q+G + W++I  +++ gR +kqc++rw+++l
  OMERI12G02760.1 131 KGHWTVEEDRKLVKLVEQFGLKKWSLIGGMLP-GRVGKQCRERWFNHL 177
                      789*****************************.*************97 PP

2Myb_DNA-binding52.31.3e-16183225145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++ W++eEd  l++ +k+ G++ W+ Ia++++ gRt++++k++w+
  OMERI12G02760.1 183 KDTWSEEEDMVLIQIHKEVGNR-WAEIAKRLP-GRTENSIKNHWN 225
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.07126181IPR017930Myb domain
SuperFamilySSF466895.03E-31129224IPR009057Homeodomain-like
SMARTSM007173.2E-15130179IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-27132184IPR009057Homeodomain-like
CDDcd001675.36E-14134177No hitNo description
PfamPF139211.3E-17134191No hitNo description
SMARTSM007179.0E-17182230IPR001005SANT/Myb domain
PROSITE profilePS5129420182232IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.9E-22185230IPR009057Homeodomain-like
CDDcd001675.12E-13185228No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MDFSCFNPQP AISHGIPFDS FLLQDELHHH AGLDHPFEAE GITLHESELA GGSVLPFATL  60
HDLDHEFFRR GSRKDFIDNA SSIFLLNPKT EVSHLVRDVQ VGAFGAYEMN GRLISRNKAS  120
RKGIKKADAV KGHWTVEEDR KLVKLVEQFG LKKWSLIGGM LPGRVGKQCR ERWFNHLRPN  180
IKKDTWSEEE DMVLIQIHKE VGNRWAEIAK RLPGRTENSI KNHWNATKRR QFARRRNRST  240
SKSGSTVLQN YIKSLAISPQ ESQMNNERSE SNPSDMMITQ GTLCSFDENN CSQSHNSEEN  300
IVPSCGDFAA EMWSGLFDTK EDEEDEAQYL LCDMDTHVDM NCIFSNMDYG SNIEPGLASV  360
VKAEGSAESR AVNLKEMD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-441302313104C-Myb DNA-Binding Domain
1msf_C2e-441302313104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126200.0CP012620.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 12 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006664387.10.0PREDICTED: uncharacterized protein LOC102717115
RefseqXP_015619155.10.0PREDICTED: transcription factor MYB98-like
TrEMBLA0A0E0FA220.0A0A0E0FA22_9ORYZ; Uncharacterized protein
STRINGBGIOSGA036541-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28063788
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.12e-64myb domain protein 98